DPCstruct | MC16195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 166 ± 13 aa |
| Standard deviation of domain lengths | 13.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A828QAW4 | 9-139 | DAISEGPVEGPVDGLKSVLLNSTPVLDSEGNTNISGVTVVFRAGEQEQSPPEGFESSGSETVLGTEVKYDTPITRTITSANIDRLRF… |
| A0A6M1CLE5 | 1-165 | MGKGGGGQRTPYEAPNDLSSRQKISLIDLISEGPIEGPEEINNVVNDLSCVYLDDTPVIDGSGNSTVNGLTAQWRAGTLEQPGLYGF… |
| A0A6L5VP66 | 1-173 | None |
| A0A2C5THJ0 | 1-180 | None |
| A0A827H6B6 | 1-173 | None |
| A0A7W4N151 | 7-157 | None |
| A0A830WJS1 | 1-173 | None |
| A0A6P0NEW0 | 5-176 | None |
| A0A4U9WMS3 | 9-167 | None |
| A0A831F1X2 | 1-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.