DPCstruct | MC16193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 151 ± 22 aa |
| Standard deviation of domain lengths | 21.58 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1CJ76 | 7-144 | GSVADFNRGMESILPQALAQLDAQPAAVTRQMFDSIDGRWWDKRQRVPEKFLVLRRDYSVSDDRLPSQPARETAAGLRLALPQHYRG… |
| D2TWI3 | 124-275 | SNLLGARIALTLILQGQASSVSQFSAGMTKTLPSALKELGAYAKNETQQMFDQVDSLWWNSKMHVPDKFLLLKRDYETSSTRMPVMP… |
| A0A1V8M8P8 | 261-430 | None |
| A0A826Y8W6 | 87-232 | None |
| A0A5K7S7R7 | 126-296 | None |
| A0A838F574 | 113-257 | None |
| A0A378B2F1 | 3-125 | None |
| A0A7V8SVD7 | 1-175 | None |
| A0A534QZG7 | 128-310 | None |
| A0A6S4Y387 | 6-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.