DPCstruct | MC16192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 132 ± 6 aa |
| Standard deviation of domain lengths | 5.98 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 44.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8VBV8 | 3-135 | KYEPEPFKIKATEPIRLITREEREKVLQKAYFNTLNMASSDIFIDLLTDSGNSSMTDRQWSGLMMGDESYTGSRSFFRLEEVVQSLT… |
| A0A6M1CIS1 | 1-142 | MKRIPEPFRIKMVENIRMTTRNEREVALKEAGYNPFLLPGDVVFIDLLTDSGTGAMSDRQWAGLMMGDEAYAGSRNYYHLCDQVKKL… |
| A0A7V4HGC0 | 2-134 | None |
| A0A7S3Z8G5 | 24-152 | None |
| W4TQK5 | 1-124 | None |
| A0A0S8HYQ2 | 1-122 | None |
| A0A7R8W2J4 | 2-130 | None |
| A0A4Q2WJ00 | 1-134 | None |
| A0A076MN87 | 32-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.