DPCstruct | MC16184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 181 ± 25 aa |
| Standard deviation of domain lengths | 24.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8Y3H6 | 3-125 | SGSDKINYTYMLTRCIQACKTNPEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQNIYLTTGYAGSKNGSRDRATELAVKLLQKRI… |
| A0A1A8U8Q3 | 1-166 | MGQKCGPCPQAPTEHQPFFNRLYKAVAWKLVSAGGFGPNLDHFEILRSCVESCKQTLTCVFVPLKDIAGLPASRAQKEGHVCEIRCQ… |
| A0A6P8QK12 | 1008-1202 | None |
| A0A7J6BA45 | 629-822 | None |
| A0A6P7XB65 | 718-928 | None |
| K7FTX3 | 316-496 | None |
| E4XEV6 | 125-292 | None |
| M7BBT3 | 554-749 | None |
| A0A6P3H231 | 123-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.