DPCstruct | MC16183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 108 ± 5 aa |
| Standard deviation of domain lengths | 4.57 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 75.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6NTU0 | 1-110 | MQRSAADKIERGFGRNEGTLGGDGQTPDRVPETPVRAKFEPKQPKIRRPGTGCIFRISEKKWEGSYSPKLPNGKRKKFNIYADTREE… |
| A0A1C6AUL0 | 29-133 | MRKTAAAKIDRGIAKSETTQDMDTVPRKPTPSTFQPYKGQRRKPGTGCISQINENLREGRYSPRLPNGGRLARNVYAHSKEECEQKL… |
| A0A645IK61 | 5-109 | None |
| A0A4R2LWW8 | 80-181 | None |
| A0A1Y4WHP4 | 62-173 | None |
| A0A2U1CDN5 | 30-134 | None |
| R5SHM6 | 1-103 | None |
| R6TKJ8 | 220-336 | None |
| V2YHG2 | 116-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.