DPCstruct | MC1618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 810 |
|---|---|
| Mean domain length (aa) | 143 ± 24 aa |
| Standard deviation of domain lengths | 24.13 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.84 |
| Pfam Score | 94.89 |
| Assigned Pfam label(s) | PF13884- PF13887- PF04917- CL0073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D5N5T8 | 20-144 | LTLYYNTVGKGTFDNTTGAYTATSDRRLKKDISVLNSQLDKVRRIPLYQFHYLDNESSAPYSIGVMAQDVLNIYPDAVVSSENKEGE… |
| A0A6C0AS56 | 21-169 | IKQFIVGVGSQAVWIYKKLSSGLIVQTPANSSKPVLINSDLYVNGSIFNPSDKNLKKNIEPITDDKCNSIINLEPVEFNYKDDKLQR… |
| A0A2N5YRE7 | 738-882 | None |
| A0A2N5YMZ4 | 313-466 | None |
| A0A559QNE9 | 580-740 | None |
| A0A7U8SRJ5 | 808-944 | None |
| A0A845D6V6 | 480-668 | None |
| M2SF78 | 32-165 | None |
| A0A349MLS3 | 422-580 | None |
| A0A6N7NVV1 | 90-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.