DPCstruct | MC16179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 112 ± 7 aa |
| Standard deviation of domain lengths | 7.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1M3X9 | 357-464 | MDRRPQLANSVLLRQNPHTVKQWHRRVKIFEGNPTKQILTYTEAVRTIDPMKAVGKPHTLWVAFAKLYETHKDVANARVILDKAVQV… |
| A0A161ZL55 | 367-484 | MDRRPELANSVLLRQNPHNVEQWHRRVKIFEGNLARQLETYTQAVRTIDPMKAVGKPHTLWVALAKLFETHNGINDARVIFDEAVQV… |
| A0A6A6LX63 | 163-280 | None |
| A0A448X185 | 207-318 | None |
| A0A397ASK1 | 476-598 | None |
| A0A4U5NES3 | 12-140 | None |
| A0A1A9VU80 | 1-106 | None |
| A0A1J3HH20 | 142-253 | None |
| A0A6V7TJN2 | 330-436 | None |
| A0A367XQQ9 | 329-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.