DPCstruct | MC16178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 154 ± 22 aa |
| Standard deviation of domain lengths | 21.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5FEP7 | 2-152 | QQSVPISTVTGGGWTECFREGFDGDDISAVADVLANCPGADLMMACSPTGSDTLTLLAQASRADVTFEAGTGNVTNNANGVEWYFND… |
| A0A816FDR1 | 6-150 | YQHQPISKDWVLVYNQSYSHPTTHEELQSIQCRTNQKILIGAQYIRNDTTTLYLAAVGPSDLLQNLNTELNQPKQLGDVYWYLTPKK… |
| A0A813V4J9 | 55-206 | None |
| A0A815LKX9 | 113-251 | None |
| A0A818FKZ0 | 290-458 | None |
| A0A814Z396 | 757-907 | None |
| A0A815S4I5 | 523-694 | None |
| A0A0V0QCC9 | 67-192 | None |
| A0A7S4NRG6 | 8-138 | None |
| A0A7S2RVU8 | 515-659 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.