DPCstruct | MC16177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 111 ± 15 aa |
| Standard deviation of domain lengths | 14.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03121 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816F4M5 | 7-110 | LYSAVVERASIEHLPPEYADIEKFIAEMVGATGGRIRKIRPLDQRGTYRFEITGTYRYCENIHRQHKKNQIYFIIDPIKRIYYQKCY… |
| A0A6A5ADX6 | 3-98 | GGGTSPMPQLESFVMALATRTNGVDAVVRAWQVTHRKSITFHLMHNRFCHHVRRAHKSNNVMYVVDLVRHVVVQRCHDPLCAHYTSP… |
| A0A821U7F1 | 19-127 | None |
| A0A819MEF5 | 113-216 | None |
| A0A819Q4P4 | 483-582 | None |
| A0A818Z8D0 | 89-197 | None |
| F6H6B0 | 556-651 | None |
| A0A820BNZ5 | 106-213 | None |
| A0A6P6CMG8 | 145-258 | None |
| A0A820F709 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.