DPCstruct | MC16175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 157 ± 13 aa |
| Standard deviation of domain lengths | 12.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 54.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816DVP5 | 11-158 | IPEYENNDYIGENFKRNIETVSKTRFIFNPLICRWKTQQQVTITIESGEVTVIGREMQNQLVRNEFKAFIGWLRNCGAFSMIIRSEP… |
| A0A820G145 | 10-174 | ENKNPPNSAKYANLARNLEGVMKMIRIFNPMKWRWEAQKQVKITVNSDTATKTCRITIKGRDSDIKIVKEEFDSFLRWLQDCAVIRH… |
| A0A817HH42 | 131-283 | None |
| A0A814CJW1 | 396-561 | None |
| A0A816PWU4 | 2-191 | None |
| A0A822DBM4 | 1-147 | None |
| A0A821SFC7 | 36-184 | None |
| A0A815Q504 | 57-212 | None |
| A0A820AYX5 | 1-140 | None |
| A0A817GWD4 | 6-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.