DPCstruct | MC16174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 154 ± 32 aa |
| Standard deviation of domain lengths | 32.23 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7PXA0 | 1-107 | MQSRPRIDPVLLYIRTQMLCIAHAPLSTLLKSCLTFSQTQFKETLTISWYLLTHKDPHIAIAAASMFIVTSIRRPEDILAIMHRDMS… |
| A0A816BKU5 | 1-178 | GVVSSAKLQVVINMSIRVGVNYHAIVTTTISGYNTHGTRTNHEMAYGNVFETVDPLFEQQINTHFMGIASYLEEHVGTLSQVPLMIL… |
| A0A820C7Z2 | 65-233 | None |
| A0A5E4C2S0 | 45-193 | None |
| A0A3Q0IUR6 | 66-181 | None |
| U4TYI9 | 922-1053 | None |
| A0A4U5TX70 | 509-657 | None |
| A0A6V7W2D0 | 507-701 | None |
| A0A0R3QZT3 | 180-389 | None |
| A0A0C2GTE9 | 1-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.