DPCstruct | MC16173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 197 ± 31 aa |
| Standard deviation of domain lengths | 30.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.61 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0010- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5WB19 | 24-184 | LQKICGKFKGIQGHHNSCYLDATLFSMFTFTSVFDSILYRCPGPKDIQHYRDVQKVLRDEIVNPLRKQLFVRSDRVMKLRELLDQLS… |
| A0A816BC27 | 77-235 | FEELKCERNKLPPLKKPLIGEYIGIQGESNSGYLDATLYWMFAYNDVFDKLIYSPEVKNRQCMDYVSCDAILDLRHRLGKATKDHTF… |
| A0A6L5CT50 | 308-558 | None |
| A0A368GA14 | 279-523 | None |
| A0A1I8I4G9 | 53-210 | None |
| A0A0S4JSH5 | 10-217 | None |
| T1GTD7 | 506-700 | None |
| A0A6J2U6N2 | 530-708 | None |
| A0A1A7Z6F6 | 337-564 | None |
| A0A0U5GCA7 | 104-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.