DPCstruct | MC16170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 137 ± 11 aa |
| Standard deviation of domain lengths | 11.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7PKU2 | 3-150 | MNLTRMRDFGLEARLVGLAAEYRNDLEYRDQDLFNIVLHDHPDRVLVGPCRWNFIHGVCWSKLACQNEIPAIVHGTENTFFDPLKEK… |
| A0A816AET3 | 17-156 | NMIDDILKIYNIYEKNITWGDQCLLNIYFNQYPERLLEFTCEWNYRPDHCMYENNCPTTEIMGIKLLHGCRGAFHNEKYQEFKAIYR… |
| A0A672SJ92 | 124-254 | None |
| A0A2G9RF41 | 132-266 | None |
| A0A1A9WYQ5 | 212-354 | None |
| A0A834CN37 | 180-329 | None |
| B7P2L5 | 3-138 | None |
| A0A444SPF1 | 1-135 | None |
| A0A5N5SMN0 | 4-130 | None |
| A0A1D2N2P9 | 248-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.