DPCstruct | MC16164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 252 ± 56 aa |
| Standard deviation of domain lengths | 56.22 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 23.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11740 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0H4L4 | 9-237 | QDHVNAIANRLKSTGAKPTVRLIIAEHGSGSPGTVHPMLKNWESGQPQQATGITLSPVLMRVLQEHFGQEVARATAEVQSQLANSEE… |
| A0A353PFF9 | 3-236 | ETPTPITYDDVVCAAQALLAAGDKVTTIAVREQLGRGSFTTIKKHLDRWSAEQAPNPAPAPTVPPQLESLWSEARREAEERLAAERA… |
| A0A0V8SMT3 | 1-232 | None |
| A0A2N7TR40 | 116-440 | None |
| A0A883CMH8 | 1-341 | None |
| A0A1H7EXW9 | 3-323 | None |
| A0A7Y7D642 | 1-241 | None |
| A0A832J7C4 | 22-165 | None |
| A0A1T4PEZ1 | 1-271 | None |
| A0A1F8W286 | 3-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.