DPCstruct | MC16163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 6.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353D704 | 7-91 | KRVGKQPVPDNVHHIMNPDQLLTYRGMQAFGWHLKFVRRPLFQRVVFMMTHPDRDELAVIEENGAFNKEHDITVRNIMFQDDQEL |
| A0A2U0AH16 | 1-80 | MDRRIGISAIPSDPNSYLNEQQLLGLIHLREYGWTTFCVRRASGNRESAITILRNKHNRMLGILNEDGTLRLAQNLKVRD |
| A0A0Q8ENM6 | 25-104 | None |
| A0A496X4D8 | 16-103 | None |
| A0A7Y6YCM5 | 14-91 | None |
| A0A7K4ERD6 | 100-183 | None |
| A0A1G0IAP5 | 1-64 | None |
| A0A2T6N297 | 1-88 | None |
| A0A2A5HY54 | 11-91 | None |
| A0A2T6NR88 | 58-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.