DPCstruct | MC16162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 126 ± 15 aa |
| Standard deviation of domain lengths | 15.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353D3F3 | 5-125 | KPVSPASLDDAKVSVGLTSTINKWKQLYSALFTLWHDSVEYREWAKQQLLDETGSINLAGLQLAQQCNVKRKTYYWLFQDYSDKDYV… |
| A0A379BBC0 | 2-109 | DVIKWQENWQACDQLQMNGSILEQYALAEISEPKSTLSKHGRYLVNEIERHTGIPTYYYLYRIGGNSLAQEQQRCCPQCQKKWQLAQ… |
| A0A3S4VEC9 | 29-163 | None |
| A0A150HT61 | 3-140 | None |
| A0A259U0Z9 | 121-267 | None |
| A0A6J4T2U8 | 46-162 | None |
| A0A2R7K8J6 | 18-141 | None |
| A0A3M2DYA2 | 161-302 | None |
| A0A853I6L6 | 3-97 | None |
| A0A2N1PI83 | 4-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.