DPCstruct | MC1616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 142 ± 11 aa |
| Standard deviation of domain lengths | 11.47 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0DX14 | 30-174 | MKYTLKYVPVGLTAKDSLLQKKYLNLSRKAYPKGVYINRPILKSYKHRNSSHVYRATNIYGVSTMKPTRQLARATGCKKWALEKIVR… |
| A0A6C0AJU6 | 1-140 | MYWPARYFTGLTQKQNKQRKSTATRRRKMSWKDPRAYRPFKTDQGVKTRTSKYVREWKKTFPEAHGLQAYSKATGVPLPIVRASYNR… |
| A0A2D7CN28 | 19-165 | None |
| A0A2E4CAW2 | 143-288 | None |
| A0A2E4IIV1 | 2-134 | None |
| A0A1Z9LSV1 | 244-388 | None |
| A0A6C0CY40 | 262-404 | None |
| A0A6C0DJ55 | 211-353 | None |
| A0A6C0CWS6 | 380-507 | None |
| A0A2D8XJH3 | 11-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.