DPCstruct | MC16154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 326 |
|---|---|
| Mean domain length (aa) | 415 ± 92 aa |
| Standard deviation of domain lengths | 91.59 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.57 |
| Pfam Score | 89.17 |
| Assigned Pfam label(s) | CL0109- PF05485- PF00621- CL0062- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836M2T4 | 3-327 | SGLILSWKFKYPVATAWSTAGLALIMATGSGYSLNEAIGAFLVGGLLTAILGFSGIFQKALSYIPQSLTSAMLAGVLLKFGISLFAS… |
| A0A2S2P4Y6 | 17-422 | LGPTAIMAIMTRENIHDMGPEFAILLCFITGIVQLIMGFAQLGFLIDFISGPVSAGFTSAAAIVIATSQLKDLLGINIKANSFIGFW… |
| A0A7X9GAK3 | 2-238 | None |
| A0A1Q9CC96 | 103-594 | None |
| A0A2U1QM09 | 5-251 | None |
| A0A3N5XKH4 | 231-658 | None |
| A0A7R8X2U0 | 2-410 | None |
| Q9SEV7 | 185-713 | None |
| A0A6I9Z059 | 50-330 | None |
| A0A248ZZE1 | 38-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.