DPCstruct | MC16152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 244 ± 39 aa |
| Standard deviation of domain lengths | 38.56 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.69 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0323- PF11815 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1AA24 | 127-384 | VFIIGWVLVLCVFYAIVRGYVALYEYLFTWTGQRKVLRQKLRSSKTYEEWVENAKALDRFLGLDEWSSHTKFSYYDYKTVQKTIHKI… |
| A0A850GRR6 | 5-232 | SRIAKYRRMLAEAPHYEAWKAAALELDFLEGNAEWKEAFASDLYHYELIHDRLSSLKQYRQHNDFERLKRALREGLHHDLGNMGNPA… |
| A0A066W0N4 | 398-643 | None |
| A0A813A799 | 57-248 | None |
| A0A2M8BQK2 | 11-225 | None |
| R8BSR6 | 77-317 | None |
| A0A7S4JUI6 | 7-192 | None |
| A0A7R7ZJE9 | 2-226 | None |
| A0A6A1UYL6 | 34-322 | None |
| A0A0D2XEG7 | 207-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.