DPCstruct | MC16151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 6.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 51.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G2N771 | 5-65 | NCHKCTADLETVIPGTKIVLKGMVDRMILCPSCGNKRCPKASDHELECAGSNEAGQKGSVY |
| A0A522A4S0 | 8-69 | TAAHQRLASPYNIGCRCNLCVSARRIFRIVCPDCGNKRCPKASDHRLACTASNAPGQLGSIY |
| A0A8B3JTV7 | 242-299 | None |
| C6WB99 | 264-342 | None |
| A0A2J0PF48 | 105-163 | None |
| A0A5B9YX29 | 1-71 | None |
| A0A7L6JNV4 | 129-179 | None |
| A0A220RB25 | 1-66 | None |
| A0A286P6T1 | 76-138 | None |
| A0A2R2W6C7 | 6-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.