DPCstruct | MC16150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 61 ± 6 aa |
| Standard deviation of domain lengths | 5.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R9MF50 | 483-544 | AGPVAITGAVRLGRFGKAGLPSAAAAENKYASIIVMDATGGPKLCVSDGTNWCVANTTTVVS |
| A0A0Q6F1Q9 | 58-111 | DGPVRPKAYTVATLPAAAGIAGAIVHVADESGGPVPAFSDGTVWRRMTDRAVVS |
| A0A7Z1UTN5 | 783-849 | None |
| A0A318SL07 | 303-361 | None |
| A0A1H8PK40 | 160-228 | None |
| U1XGI5 | 145-199 | None |
| A0A329HSN1 | 247-314 | None |
| A0A1T5JPY3 | 654-705 | None |
| A0A560D0P4 | 364-428 | None |
| A0A8B2NJW4 | 767-831 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.