DPCstruct | MC1615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 4.50 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0AGU0 | 1-73 | MLHTNPFIRDIEKPSCVECMYYQVESTSILNKCTKFGGKDLHTGDIVFDYADSVRYDESKCGKVGHYFKRATF |
| A0A6C0EVS8 | 46-118 | KFFIRNKELPSCSNCLHFIEYTNNNPFDGNRCKKFGEMDLITGAIKYDLAAVCRLCDSNCGKKGLHYTAKNQT |
| A0A6C0HSM9 | 1-77 | None |
| A0A6C0DWT8 | 17-100 | None |
| A0A6C0KJH0 | 4-85 | None |
| A0A6C0B917 | 10-87 | None |
| A0A6C0ASF5 | 14-98 | None |
| A0A6C0ARJ3 | 6-79 | None |
| A0A6C0ICV7 | 29-113 | None |
| A0A6C0B2Z8 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.