DPCstruct | MC16149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 371 ± 85 aa |
| Standard deviation of domain lengths | 84.79 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.67 |
| Pfam Score | 75.63 |
| Assigned Pfam label(s) | PF17057- PF21026- CL0441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EEG1 | 7-305 | KEVDVHIMQKNKEQKNQEIKTVVKYITACLNTDGGVVILKNNDWKDATGKYLDDWYGIVEQKLFDECSKFIKFEGTYQDKILRLRIT… |
| A0A6P3FAE4 | 19-388 | VIDVGTITLGEEARKNRKDHQLNAHERVNLLRGLSASLKGKVALLTGKMKNEGYAYEHGIGQDLEQAFGKIVSDVHNHLDFMVRGST… |
| A0A096MK07 | 98-575 | None |
| A0A5E4APR2 | 27-339 | None |
| A0A2T7PA12 | 20-482 | None |
| A0A1G5SJA0 | 9-498 | None |
| A0A6P8IB11 | 1-369 | None |
| A0A5E4BYE3 | 2-304 | None |
| A0A8B6CHU0 | 2-289 | None |
| A0A8B6HFW4 | 2-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.