DPCstruct | MC16148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 147 ± 20 aa |
| Standard deviation of domain lengths | 19.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.70 |
| Pfam Score | 98.91 |
| Assigned Pfam label(s) | PF02936- PF04113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2NRP4 | 1-116 | HLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALIIMWQKRHVYGPLPQSFDKEWVAK… |
| A0A6P3F5F7 | 22-179 | LRRGPGMRGTHSPGGAAGGQAKMPPYTNHHAQRYYPMPDDPFCTDLSAEQRILKEKEKSSWTQLSHAEKVALYRIQFGETFAEMNRR… |
| A0A1A9V1W7 | 23-174 | None |
| A0A1E4SBW2 | 328-474 | None |
| B5X9Q6 | 1-137 | None |
| A0A287DGC0 | 3-145 | None |
| A0A6B0RA43 | 846-997 | None |
| A0A1B0AFL4 | 22-186 | None |
| A0A6J8DDE7 | 84-255 | None |
| A0A7N4PCL5 | 179-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.