DPCstruct | MC16144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Standard deviation of domain lengths | 10.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 40.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497EJQ7 | 3-100 | EEALLDLFRAMEGILGPNYECRYYPCHFSGQDCTFCFCPFYPCFLYRLGGEIIVSSKGNYVWSCKNCWWIHEKQNVEAVVNYFSGYS… |
| A0A7K4AA87 | 14-108 | DKVVESLSRPNGTNVDCEYYPCHHQGQDCTLCFCPFYPCLDDRLGKYVKSRRGGQVWSCEDCLWIHRPDVGRDVKMRLHGSDRPTHN… |
| A0A7V3VV09 | 9-105 | None |
| A0A3D1FDY8 | 8-99 | None |
| A0A1V4UQ94 | 222-302 | None |
| A0A843DKY7 | 80-164 | None |
| A0A847V5R0 | 136-226 | None |
| A0A7J4ENE0 | 23-115 | None |
| A0A7C4S5X7 | 7-101 | None |
| A0A0F9GK18 | 2-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.