DPCstruct | MC16141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 9.58 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532T4D8 | 2-97 | IVKTHQTEDKRILLVVCDNEILGKKFEEGNKQLDLTSDFYKGIEKTELEVCDLMRNCDMINLVGEKVINLAIKEGVIDSEHVKKISD… |
| A0A7J9Q090 | 23-119 | MIMTKIHTSGSETILAACDSELLGKTLEEGDICISVNSTFFGETEVTEDEFRGMLACATSANIVGEKAVNIAIELNCIHPDAVMRIL… |
| A0A7C5B8M5 | 31-127 | None |
| W8NRL8 | 2-104 | None |
| Q8TWR4 | 5-112 | None |
| A0A3N5V616 | 4-84 | None |
| A0A7J2SVX6 | 3-84 | None |
| A0A645HQV2 | 2-76 | None |
| A0A1Q9NIN8 | 17-118 | None |
| A0A524FVL4 | 46-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.