DPCstruct | MC16138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.13 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J3AQ20 | 1-56 | CPRCGYSSLERMPTDQCLIRYKCKRCGFVMTPKEGDCCVFCSYGSVPCPPIQEMRS |
| K2A525 | 1-63 | MTKARLVCPHCKKEEHVEMPKTYCQIYYKCSFCSRLIETQDGYCCVFCSYADVQCPYSQRQEE |
| A0A2G9MBI5 | 56-116 | None |
| Q1W4V0 | 3-67 | None |
| A0A6J4FHL5 | 1-65 | None |
| A0A6A4UUB8 | 2-64 | None |
| A0A7C3ZU74 | 8-71 | None |
| A0A2S6RHB0 | 261-323 | None |
| A0A521QG10 | 3-66 | None |
| A0A661GP49 | 73-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.