DPCstruct | MC16137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 103 ± 18 aa |
| Standard deviation of domain lengths | 18.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O74102 | 3-94 | RFVVWPCELDSRLSRKYGRIIPKNLAIEKPSLDEIIEVAETLNLKIVEVDREKLNPRLSGIDEELRTYGRIIIESPYGKVKTLRLIA… |
| A0A7J3ANB9 | 4-94 | LVHERDRRKVIWPSYFDSRLSRDAGRRARKSYCIEKPDIERLSLVLKSMNLKFEVEKDKKHPARWWENEGRIRVETNMPKSKLIEAI… |
| A0A2K6KUZ8 | 3-78 | None |
| A0A0G4LMI8 | 608-712 | None |
| A0A835IYK8 | 21-126 | None |
| A0A395J605 | 171-289 | None |
| A0A814SGR6 | 70-186 | None |
| A0A5J4Z2C1 | 37-153 | None |
| C4JIT1 | 49-136 | None |
| A0A077YD54 | 9-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.