DPCstruct | MC16132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 93 ± 11 aa |
| Standard deviation of domain lengths | 10.54 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V2RFR1 | 149-236 | MRHGLIRAKAKAAVRIAAEARITPAMLYVRGWPTRMLTDVEADILASVRREVTGLFGFQSRSLDRDAVHGRYAQLLAERAAKVERRRT |
| A0A654BRZ9 | 1-105 | MADVARAKAAASERQTIEAQIPAHLFFTSGLPTVRPTPDEARLLASVRRRVAQTVGIEVDHTSATDVMRRYDELLAQRQGAPSAADA… |
| A0A069PLN3 | 48-136 | None |
| A0A072TPX0 | 197-282 | None |
| A0A810YDH9 | 130-222 | None |
| A0A094X5E3 | 87-172 | None |
| A0A0Q6RXM2 | 38-119 | None |
| A0A1G6PSK7 | 208-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.