DPCstruct | MC16130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 127 ± 5 aa |
| Standard deviation of domain lengths | 5.23 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A158L4X1 | 30-158 | DVPLVVVDIFQGGVSDAFPGSLSICKVEDSTGIRRTGQLGLLGKAASLLASCSRKIIEVPLRDGTMTATVARFQRGVPFPLYRVDMA… |
| A0A6N4TYA7 | 2-128 | TVYAGKHTVEPIEQPAVYRSVTEIDPRVRLWKRCKAAICVGGFESPTPPYPPVLTVSTAFISENSADGVEMNEARLNILIKDGVAGV… |
| A0A3E0CN13 | 12-131 | None |
| A0A1P9Y231 | 131-253 | None |
| A0A4R0WN56 | 3-132 | None |
| A0A2T0QN02 | 63-185 | None |
| A0A7W8QD81 | 22-150 | None |
| I5D070 | 62-189 | None |
| A0A5C6V1L0 | 127-253 | None |
| A0A158FHI3 | 257-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.