DPCstruct | MC1613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 5.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1LX45 | 1-74 | MNIEYVAFYQSQKVFREDSGIRYYGKIKEIKRYKRSECKEIPCEKGSEEEKYLRIDFEWIKEIPKIEPIQYGHK |
| R9L6L8 | 35-97 | IEYIAMCQSRKKFLGPGNTGIHWFGRVLDWKVVRRREITERPARPGTEEELYVKFTIERWERR |
| A0A133ZYQ4 | 478-555 | None |
| A0A1H3BMS1 | 134-202 | None |
| A0A1S9N773 | 5-75 | None |
| C4III3 | 74-133 | None |
| A0A1H0KNS0 | 218-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.