DPCstruct | MC16128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 7.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0DIJ9 | 2-98 | TDIYPPNSRYYAVPMRSTQNADGTKTEFVGRRIIPARSRYRALTHHRSAGDERIDTVAAEAFGDPELYWRICDANGDADPATATTPA… |
| A0A158KML7 | 14-116 | IPTAAFPANSRYAATATQTYTFADGRTASYLARRFVPDPALFSVIGQVQVRQNDRLDLIASTYLGDPILFWRIADANGAVRPADLLT… |
| A0A1I0F1F8 | 1-80 | None |
| A0A3E1NGC5 | 19-109 | None |
| A0A6I6E8T9 | 1-79 | None |
| A0A2N3YXV5 | 39-131 | None |
| Q1QPZ8 | 12-107 | None |
| A0A3B1EJD0 | 1-89 | None |
| A0A2D6M9U6 | 2-99 | None |
| A0A7X5VVD4 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.