DPCstruct | MC16127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 234 ± 29 aa |
| Standard deviation of domain lengths | 28.68 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H1Q832 | 211-432 | LRIILTIQIREEIAAGRLGIAPRFTLLDERQLIAIDIISARYGYQNSFVALRTYKEIYECGKRFEIPDLESIPKYTEKDVAFRAEVP… |
| A0A158KMG6 | 2-248 | LRKLCSIDAAERDRAEAHSGAVATGAIPYTEENRRLCEPQFEFVTPQQLVAIDFFLSMHHYAPHAFPALAIWHDVNVLGRRYPTPTL… |
| A0A706LSZ4 | 176-428 | None |
| A0A5H2YPX2 | 196-439 | None |
| A0A0D7K482 | 182-381 | None |
| A0A168PPP4 | 64-316 | None |
| A0A810YHD8 | 59-318 | None |
| A0A085FP98 | 3-221 | None |
| A0A7D5UK66 | 148-426 | None |
| A0A1E5X8V3 | 62-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.