DPCstruct | MC16125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 8.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 29.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0L0D2 | 8-66 | RTPNYKLGDRVYLNSGGPEMTISDIELQIRTDEFTGTYRCQWFGGKKLERGTFPEESLT |
| A3WZU7 | 8-63 | RGLTALAPGDVVALRSGGPRMTVVQVLKDQVECTWFVNGQPVKQSFPPSSLRYMDV |
| A0A167WSL4 | 2-57 | None |
| A0A857C5W9 | 64-143 | None |
| A0A316FZZ7 | 1-67 | None |
| A0A1V5UH79 | 137-196 | None |
| A0A1I3MG52 | 3-56 | None |
| A0A537MFI7 | 28-93 | None |
| A0A1Q5VHB3 | 3-61 | None |
| A0A378I5N6 | 3-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.