DPCstruct | MC16122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 131 ± 11 aa |
| Standard deviation of domain lengths | 11.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.60 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0010- PF05901 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8B9S2 | 11-134 | KSENEVFVNEYLVKEGYALGATYPPDVKYQLLFKEAEKEAREERRGLWSSCQEEVSDVSKVPNEDDNVTVNQSTDTIECSLNKYNCS… |
| W4LHP8 | 60-188 | VKPVTTDRHGRIVAHVTRDDGLHVNAAMVEAGAAYVYRRYTDDPHLIALETVAKEKGKGLWSLPSDQRKPPEQWRREHENETDRIGF… |
| A0A378QS51 | 207-344 | None |
| A0A3M2D9P4 | 38-168 | None |
| X6C8B7 | 5-130 | None |
| A0A7J4QFA6 | 18-132 | None |
| A0A6L6IS24 | 32-158 | None |
| A0A0G0MM59 | 118-261 | None |
| A0A838QI86 | 1-114 | None |
| C0DS44 | 263-411 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.