DPCstruct | MC1612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 149 ± 14 aa |
| Standard deviation of domain lengths | 13.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A0LGS1 | 69-193 | VEGQTVPWKPAAWRRSFAGSERAFDELSEHVETHGGIKRGYIRERAGGDPVELFLLSMAWGYGTVGYGPTRVSRVLSQPDAAAKLAA… |
| A0A3D3LYG5 | 34-198 | LARTRKTTAEVADLIRNGQRIPTTVEVENHAIRFYPRHWLNRWGENMPVIPSVFQSGEKDSKGRLTLSCGDLFTLGTMVETAQNAVN… |
| A0A6H1LLR1 | 1-171 | None |
| A0A209C4J0 | 16-166 | None |
| A0A0R2XFM4 | 6-143 | None |
| A0A1C4Y5P3 | 1-156 | None |
| A0A7W3PF43 | 21-153 | None |
| A0A6H1L226 | 11-166 | None |
| A0A640S5R9 | 1-151 | None |
| A0A7W8CM79 | 8-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.