DPCstruct | MC16117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 259 ± 52 aa |
| Standard deviation of domain lengths | 52.29 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7KS56 | 29-260 | DSQISHTKTHSDNERNSVTNILEAGEISFFSRGRLGIDNPIEAEDVARAYLVLRPSVQVGQSLKGLIASDNVSRLLVLPKKRLPAKG… |
| A0A512DWK5 | 2-244 | AEKKERQRTEVVEHGNIWFIYRPKVRAEDEPEQDVDGIDDVERFHMVLRPDARSGGTARFRLMTIGAKRLPDTGEHERNWGFVDLVA… |
| A0A538QAQ7 | 1-188 | None |
| A0A167HG07 | 412-715 | None |
| A0A2E6Z8W0 | 1-216 | None |
| A0A0G2I9J1 | 391-631 | None |
| C1GAF4 | 403-694 | None |
| A0A6A3BDL9 | 1-238 | None |
| A0A6P8CCJ8 | 21-250 | None |
| A0A814MDK4 | 2-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.