DPCstruct | MC16116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Standard deviation of domain lengths | 17.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4WNV0 | 4-96 | RKKYLTAKYGAHQMALIRKRLGVEMWLLDEMTKLYDNCQPGDQAELDLDELLDIDGTSHRRAYLQRLLGDASAAPRTQVDAFIEELL… |
| Q8R4R9 | 9-162 | EAAGGTSGGGARVFFQSPRGGTGGSRESSSHSGSSREDSAPVATVAAAGQVQQQQRRHQQGKVTVKYDRKELRKRLVLEEWIVEQLG… |
| A0A3Q2UK66 | 72-211 | None |
| S4RJC1 | 10-142 | None |
| A0A7R8X9M3 | 16-147 | None |
| A0A2K5MYT6 | 7-151 | None |
| A0A2R9BMV3 | 6-143 | None |
| A0A1A8K1C7 | 42-159 | None |
| A0A210PMP0 | 36-168 | None |
| A0A6P4Y2L3 | 4-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.