DPCstruct | MC16115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 3.73 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 70.05 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0023- PF09365- CL0412 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443I893 | 1-65 | MDMRKKKKKVLLMGKSGSGKSSMRSIIFSNYVAKDVRRLGATIDVEHSHVKFMGNLTLNLWDCGG |
| A0A6S7LAQ5 | 1-53 | MGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGG |
| A0A0V0QBC9 | 373-437 | None |
| A0A814DGA9 | 2-53 | None |
| A0A3P3YF44 | 2-60 | None |
| A0A5N6KYV1 | 672-732 | None |
| A0A4S4M2V3 | 211-275 | None |
| A0A0F7ULF7 | 2-66 | None |
| A0A813ZD54 | 200-260 | None |
| A0A3M7M0U2 | 773-834 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.