DPCstruct | MC16108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 10.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402G1P4 | 82-177 | LATLVAIYVDTIRSGSMPCMENTVQALAKIENSAAVHEATFCYMELMDQKLKLPTETLQELLGIHAKCEEEALQVFMARAFKDDQQA… |
| A0A402GBU3 | 4-80 | MENTVQALAKIENSAAVHEATDCYVELMDQKLKLPTETLQDLLGIHAKCEDEALQVFMARAFKDDQQAFQAELMEVL |
| A0A401RU40 | 309-419 | None |
| A0A498LIE8 | 175-268 | None |
| U3IPW4 | 108-201 | None |
| A0A821BFK3 | 20-120 | None |
| A0A821BN21 | 2-101 | None |
| A0A212CF95 | 118-196 | None |
| A0A212CHD6 | 178-275 | None |
| H2ZS93 | 71-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.