DPCstruct | MC16105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 53 ± 3 aa |
| Standard deviation of domain lengths | 2.54 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 65.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0552 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9PKN2 | 107-163 | VVKEMDNEKRIRLLQFVTGTCRLPVGGFTELIGSNGPQKFCIDKVGKETWLPRSHTW |
| A0A402GB59 | 1-51 | MDSEKRIRLLQFVTGTSRVPMNGFSELYGSNGPQLFTIEHWGSPDKLPRAH |
| A0A674K5X3 | 673-723 | None |
| A0A183TSC8 | 63-119 | None |
| A0A821S1Z6 | 243-293 | None |
| A0A821AR01 | 106-156 | None |
| A0A821VJJ6 | 2-51 | None |
| A0A4Z2J5X8 | 458-514 | None |
| A0A2I0T142 | 35-91 | None |
| A0A183W6K5 | 155-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.