DPCstruct | MC16104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 110 ± 8 aa |
| Standard deviation of domain lengths | 7.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13764 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4VZ39 | 617-728 | QGTQQAVAATCIPAIHRLEQISSDEHVGSVAENLLEALRDDPKIAVQVEEVRRQTRQEKKRLAMETRKKELSRLGLRANDKEQITSQ… |
| A0A402GAM3 | 1-124 | MLPSCSGAAFTHRLLSMAGFPPQVLIGTDSIPNLHKLEQVSSDEGIGTLAENLLEALREHPEVNKKIDAARRETRAEKKRMAMAMRQ… |
| A0A814GR70 | 357-457 | None |
| A0A0P4W7E8 | 442-553 | None |
| A0A7T8JY95 | 345-449 | None |
| A0A183HAI4 | 304-421 | None |
| A0A2I0T8B4 | 294-410 | None |
| A0A1I9G5X6 | 779-883 | None |
| A0A158QA32 | 813-905 | None |
| A0A2G9TYF2 | 720-829 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.