DPCstruct | MC16103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Standard deviation of domain lengths | 10.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 39.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402GA64 | 22-127 | ITLQPGSPCNDFKGYCDVFMRCRLVDADGPLARLKKAIFNPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKL… |
| A0A6P7ULQ4 | 81-184 | CAIPRMRNHCGLRMQPGSPCDAMRGYCDVFQVCRSIDPDGPLTRLQRFFFGGQAISTTIDYIADHPFWSAFALLGSAWFMVLVFRCF… |
| A0A0L7KPZ1 | 278-389 | None |
| A0A820WEB3 | 1-116 | None |
| A0A3Q0KUN7 | 296-429 | None |
| A0A822BA56 | 56-181 | None |
| A0A158RE77 | 273-398 | None |
| Q9VAI2 | 867-976 | None |
| A0A504YPD2 | 445-553 | None |
| A0A183GA91 | 121-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.