DPCstruct | MC16102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 56 ± 6 aa |
| Standard deviation of domain lengths | 6.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 74.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5E0M7 | 110-161 | EKKLPQALIIGVKKGGTRALLEAIRVHPDVRAVGVEPHFFDRNYEKGLEWYR |
| A0A402G9V3 | 9-71 | PAAPPAPAAPPAKRLPRAIIVGVKKGGTRAVLEFIRGHPAVRALGTEPHFFDRHYHRGLDWYR |
| A0A315UX93 | 91-145 | None |
| A0A4Y2BYP2 | 236-289 | None |
| A0A6B2EDG2 | 100-150 | None |
| A0A402F8F4 | 64-132 | None |
| A0A6L5DEY4 | 119-169 | None |
| A0A091EDT0 | 59-109 | None |
| A0A6P9B4W9 | 68-121 | None |
| A0A4U1FAH7 | 98-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.