DPCstruct | MC16101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 97 ± 4 aa |
| Standard deviation of domain lengths | 3.94 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.85 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF15058- PF15059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9YIC2 | 898-992 | TAMMDRYNEIMNRLKPHNYNPSYHPQFTEHIVNTYGILRERPDATGSEAQLYNDLTYLNEVIVSVVPQDKVADCLILLNCLRQLSQA… |
| A0A402G904 | 3-101 | EEQSKSMMERYHTIMSQLKTLGYDPDTHPQFTEQIVNTYGILRERPDVRGAEGDIYNNIEYLRNVVQSTVPAQKRADCVMLLNCLHK… |
| H0VFL3 | 311-410 | None |
| A0A670ZU35 | 298-393 | None |
| W5MQY8 | 246-341 | None |
| A0A1U7SQI1 | 1-84 | None |
| A0A643C8M9 | 206-300 | None |
| G7MMA0 | 194-290 | None |
| R7UDB9 | 96-188 | None |
| H3A903 | 121-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.