DPCstruct | MC1610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 10.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5STZ7 | 10-136 | ISETSDEHKQIVKKCQENIWIKNRGVAFDDDPFFEQDSPYVFASTETIEGLKAFFEHGNWAIRNGILYNDLLFINQVNGGDEWWTLK… |
| A0A521J0H4 | 5-136 | YISKEEYIREAQKNPWLKRGGIDFEEDPFMEMDYGYELTYVSSIENLLQKIGRGDWPIRQAFGYNSLVFANQVNGGDDWLAIKKFDD… |
| A0A7K4HG48 | 2-96 | None |
| A0A1C0BI83 | 2-121 | None |
| A0A1I2Y8X1 | 36-150 | None |
| A0A202DU63 | 6-121 | None |
| A0A7S9L171 | 3-100 | None |
| A0A1I6TIZ9 | 52-170 | None |
| A0A3F3P9P3 | 15-144 | None |
| A0A6N7RTL8 | 12-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.