DPCstruct | MC16098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 6.60 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 59.77 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0023- PF00617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0QLJ6 | 13-118 | PHGHHLRQDLLERFYTMSIMLAMVLLGCTGSVEERGSLLHRIISLASELKTNLGNMFGFAAVMRVLELPQIVRLDETWIALRQQYTE… |
| A0A402G8K6 | 2-92 | HLIALGIAVDILGCTGAGAERAATLHKVIQVALELWRSAGDLFAFSAVMKALQLPQVTRLEQTWRHLRQNHTASAIAFEKELKPLLG… |
| A0A2I0TP55 | 680-787 | None |
| A0A3Q2CVS0 | 632-733 | None |
| A0A2G9SDB1 | 21-124 | None |
| A0A498MJ50 | 449-550 | None |
| W5Q434 | 31-122 | None |
| A0A663FKA5 | 486-587 | None |
| A0A4Z2HXW3 | 170-259 | None |
| A0A7R8XH05 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.