DPCstruct | MC16095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 168 ± 16 aa |
| Standard deviation of domain lengths | 16.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7E8N9 | 20-198 | IRTKQEARSALETAILNARHSPVTWPKTLLFYAYSVWFMLLPSLVHLAKSKVKILRLALHVLDRMEYSGILPLDQVCYRIVIQLCGD… |
| A0A1I7TPQ7 | 115-281 | VRTKPENRSSLLAAINAVKTNPLHWSKTLLFYSYSLWFMQLDSLLAAAPNKKKIIRLAFNVLDRMEKTEVFPLDQVCYRILIELCGK… |
| A0A2I4DC49 | 494-672 | None |
| A0A1S3QGH6 | 1-135 | None |
| A0A0L7L9R2 | 457-609 | None |
| A0A2H1W0P8 | 130-313 | None |
| A0A7F5RC52 | 352-535 | None |
| A0A834FQS1 | 553-717 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.