DPCstruct | MC16094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 3.66 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 65.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378F6R7 | 7-71 | TIIGIPHDYFVSGYRDTTTNKLRLYSAVASDSFNIHIFNRGDYIKAVSDKIASENISKILYPSDE |
| A0A3S4H3U8 | 100-163 | VVAIAYDQVIPGFDTDATNTLRLWSAQASNEINLGKFNQGDYFAAVEDKNHSENVSRVLYPDDS |
| A0A2P4SCN2 | 3-68 | None |
| A0A5B7JE84 | 7-72 | None |
| A0A377D8N6 | 70-133 | None |
| A0A7J7FCV8 | 37-103 | None |
| A0A817FDW4 | 45-113 | None |
| A0A7J5Y740 | 83-148 | None |
| A0A6I9XIS6 | 182-245 | None |
| A0A183IA30 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.