DPCstruct | MC16092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Standard deviation of domain lengths | 6.93 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402G7B6 | 1-69 | MESLTGYQAVQKALSLTLVQEPPAISTVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRK |
| A0A0S7I0N9 | 1-68 | MESLTGPQAIAKAISQTLTTNPLPAATTVHFKVSMQGITLTDSQRKIFFRRHYPLNTVTYCDLDPQDR |
| A0A7M5X2U2 | 1043-1127 | None |
| A0A1Y1N9X7 | 715-806 | None |
| A0A0D8XDW5 | 118-200 | None |
| A0A5J4NZS4 | 305-401 | None |
| A0A0R3TFG5 | 10-102 | None |
| F1Q649 | 1568-1655 | None |
| A0A663MQE4 | 557-638 | None |
| A0A183T768 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.